PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr007121.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 308aa    MW: 33062.7 Da    PI: 7.3968
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr007121.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding271.1e-08653346
                     SS-HHHHHHHHHHHHHTTTT.....-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg.....tWktIartmgkgRtlkqcksrwqk 46
                      W +eEd+ + +a++++  +     +W++Ia  ++  ++ +++k ++ +
      Pbr007121.1  6 VWGKEEDKAFENAIAMHWIDenseeQWEKIADLVP-SKSMEELKQHYEM 53
                     6*****************99***************.***********76 PP

2Myb_DNA-binding38.92e-12137181347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
      Pbr007121.1 137 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 181
                      7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.32259IPR017884SANT domain
SMARTSM007172.9E-6357IPR001005SANT/Myb domain
SuperFamilySSF466891.66E-8559IPR009057Homeodomain-like
PfamPF002492.4E-6654IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-4655IPR009057Homeodomain-like
CDDcd001671.43E-8755No hitNo description
PROSITE profilePS5129417.441129186IPR017930Myb domain
SuperFamilySSF466893.73E-17132187IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-17133184IPR006447Myb domain, plants
SMARTSM007172.3E-10134184IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-11135180IPR009057Homeodomain-like
CDDcd001671.07E-9137182No hitNo description
PfamPF002497.6E-11137181IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MSSSSVWGKE EDKAFENAIA MHWIDENSEE QWEKIADLVP SKSMEELKQH YEMLVDDVGA  60
IEAGRVSPPN YTADEAANTV SSSKDSGHRA SSSGASASDK RLNCGQGGGF LGSGHDSASH  120
GGKGGSRADQ ERKKGIPWTE EEHRLFLLGL DKFGKGDWRS ISRNFVISRT PTQVASHAQK  180
YFIRLNSMNR DRRRSSIHDI TSVNNGDVSS HQQPPITGQQ TSSYAPTAAT TIGVGVGPQS  240
VKHRPQPHMT GLGMYGAPMG HPVSAPPGHM ASAVGTPVML PPGHHPHAHP PYAVPVAYPM  300
AHPTMHQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00191DAPTransfer from AT1G49010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009337380.10.0PREDICTED: transcription factor DIVARICATA-like
TrEMBLD9ZJ770.0D9ZJ77_MALDO; MYBR domain class transcription factor
STRINGPOPTR_0012s05720.11e-140(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106943340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.12e-78MYB family protein